SH3D20 Rabbit Antibody
CAT#: TA331509
Rabbit Polyclonal Anti-ARHGAP27 Antibody
Need it in bulk or conjugated?
Get a free quote
CNY 5250.00
CNY 300.00
CNY 1430.00
CNY 2900.00
CNY 6650.00
CNY 9998.00
CNY 4840.00
Specifications
Product Data | |
Reactivity | Human, Mouse, Rat, Dog, Pig, Horse, Rabbit, Bovine |
Host | Rabbit |
Immunogen | The immunogen for Anti-ARHGAP27 Antibody is: synthetic peptide directed towards the N-terminal region of Human ARHGAP27. Synthetic peptide located within the following region: GVLHRTKTADKGKRLRKKHWSASWTVLEGGVLTFFKDSKTSAAGGLRQPS |
Isotype | IgG |
Formulation | Shipped as lyophilized powder. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 60 kDa |
Database Link | |
Background | Rho-like small GTPases are involved in many cellular processes, and they are inactive in the GDP-bound state and active in the GTP-bound state. GTPase-activating proteins, such as ARHGAP27, inhibit Rho-like proteins by stimulating their intrinsic GTPase activity. |
Synonyms | CAMGAP1; PP905; SH3D20; SH3P20 |
Note | Immunogen sequence homology: Human: 100%; Dog: 93%; Pig: 93%; Rat: 93%; Horse: 93%; Mouse: 93%; Rabbit: 93%; Bovine: 86% |
Reference Data |
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |