ARHGAP11A Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-ARHGAP11A Antibody is: synthetic peptide directed towards the N-terminal region of Human ARHGAP11A. Synthetic peptide located within the following region: MLGIDGLCATPSLEGFEEGEYETPGEYKRKRRQSVGDFVSGALNKFKPNR
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	55 kDa
Gene Name	Rho GTPase activating protein 11A
Database Link	NP_955389 Entrez Gene 9824 Human UniProt ID Q6P4F7
Background	The function of this protein remains unknown.
Synonyms	GAP (1-12)
Note	Immunogen sequence homology: Human: 100%; Rat: 93%; Bovine: 93%; Rabbit: 92%; Mouse: 86%; Pig: 85%; Horse: 85%; Guinea pig: 85%; Dog: 77%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.