DPY19L3 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-DPY19L3 Antibody is: synthetic peptide directed towards the C-terminal region of Human DPY19L3. Synthetic peptide located within the following region: TNHPHYEDSSLRERTRAVYQIYAKRAPEEVHALLRSFGTDYVILEDSICY
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	83 kDa
Gene Name	dpy-19 like 3 (C. elegans)
Database Link	NP_997208 Entrez Gene 147991 Human UniProt ID Q6ZPD9
Background	The function of this protein remains unknown.
Synonyms	DKFZp686J17135; MGC35440
Note	Immunogen sequence homology: Human: 100%; Pig: 93%; Horse: 93%; Rabbit: 93%; Guinea pig: 93%; Dog: 86%; Rat: 86%; Mouse: 86%; Bovine: 86%; Zebrafish: 85%
Reference Data
Protein Families	Transmembrane

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.