DHX16 Rabbit Polyclonal Antibody

CAT#: TA331470

Rabbit polyclonal Anti-DHX16 Antibody



Need it in bulk or conjugated?
Get a free quote

CNY 5250.00


货期*
6周

规格
    • 100 ul

Product images

推荐一起购买 (4)
Transient overexpression lysate of DEAH (Asp-Glu-Ala-His) box polypeptide 16 (DHX16), transcript variant 1
    • 100 ug

CNY 3080.00


beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

CNY 300.00
CNY 1430.00


Recombinant protein of human DEAH (Asp-Glu-Ala-His) box polypeptide 16 (DHX16), 20 µg
    • 20 ug

CNY 2900.00
CNY 6650.00


Recombinant protein of human DEAH (Asp-Glu-Ala-His) box polypeptide 16 (DHX16), 100 µg
    • 100 ug

CNY 9998.00

Specifications

Product Data
Applications WB
Recommend Dilution WB
Reactivity Human
Host Rabbit
Clonality Polyclonal
Immunogen The immunogen for anti-DHX16 antibody: synthetic peptide directed towards the N terminal of human DHX16. Synthetic peptide located within the following region: KYQLVLEEEETIEFVRATQLQGDEEPSAPPTSTQAQQKESIQAVRRSLPV
Isotype IgG
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Conjugation Unconjugated
Storage Condition Store at -20°C as received.
Predicted Protein Size 115 kDa
Gene Name DEAH-box helicase 16
Background DEAD box proteins, characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases. They are implicated in a number of cellular processes involving alteration of RNA secondary structure such as translation initiation, nuclear and mitochondrial splicing, and ribosome and spliceosome assembly. Based on their distribution patterns, some members of this family are believed to be involved in embryogenesis, spermatogenesis, and cellular growth and division. This gene encodes a DEAD box protein, which is a functional homolog of fission yeast Prp8 protein involved in cell cycle progression. This gene is mapped to the MHC region on chromosome 6p21.3, a region where many malignant, genetic and autoimmune disease genes are linked.
Synonyms DBP2; DDX16; PRO2014; Prp2; PRP8; PRPF2
Note Human: 100%; Goat: 86%; Horse: 86%; Bovine: 86%; Pig: 85%; Rat: 79%; Mouse: 79%; Rabbit: 77%
Reference Data
Protein Pathways Spliceosome
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
Customer Reviews 
Loading...