KCNH3 Rabbit Polyclonal Antibody
CAT#: TA331459
Rabbit polyclonal Anti-KCNH3 Antibody
Need it in bulk or conjugated?
Get a free quote
CNY 5250.00
CNY 4840.00
CNY 300.00
CNY 1430.00
Specifications
Product Data | |
Applications | WB |
Recommend Dilution | WB |
Reactivity | Human |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-KCNH3 antibody: synthetic peptide directed towards the middle region of human KCNH3. Synthetic peptide located within the following region: LYPEFAPRFSRGLRGELSYNLGAGGGSAEVDTSSLSGDNTLMSTLEEKET |
Isotype | IgG |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 117 kDa |
Gene Name | potassium voltage-gated channel subfamily H member 3 |
Database Link | |
Background | The exact function of this protein remains unknown. |
Synonyms | BEC1; ELK2; Kv12.2 |
Note | Human: 100%; Rat: 93%; Mouse: 93%; Rabbit: 93%; Dog: 86%; Pig: 86%; Horse: 86%; Bovine: 86%; Guinea pig: 86% |
Reference Data | |
Protein Families | Druggable Genome, Ion Channels: Potassium, Transmembrane |
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |