Kv beta 2 (KCNAB2) Rabbit Polyclonal Antibody
CAT#: TA331456
Rabbit polyclonal Anti-KCNAB2 Antibody
Need it in bulk or conjugated?
Get a free quote
CNY 5250.00
Cited in 1 publication. |
CNY 300.00
CNY 1430.00
CNY 2900.00
CNY 6650.00
CNY 3080.00
CNY 9998.00
CNY 3080.00
Specifications
Product Data | |
Applications | IHC, WB |
Recommend Dilution | WB, IHC |
Reactivity | Human, Mouse |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-KCNAB2 antibody: synthetic peptide directed towards the middle region of human KCNAB2. Synthetic peptide located within the following region: WGGKAETERGLSRKHIIEGLKASLERLQLEYVDVVFANRPDPNTPMEETV |
Isotype | IgG |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 40 kDa |
Gene Name | potassium voltage-gated channel subfamily A regulatory beta subunit 2 |
Database Link | |
Background | The functions of Voltage-gated potassium (Kv) channels include regulating neurotransmitter release, heart rate, insulin secretion, neuronal excitability, epithelial electrolyte transport, smooth muscle contraction, and cell volume. KCNAB2 is a member of the potassium channel, voltage-gated, shaker-related subfamily. This member is one of the beta subunits, which are auxiliary proteins associating with functional Kv-alpha subunits. |
Synonyms | AKR6A5; HKvbeta2; HKvbeta2.1; HKvbeta2.2; KCNA2B; KV-BETA-2 |
Note | Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Zebrafish: 100%; Guinea pig: 100%; Yeast: 83% |
Reference Data | |
Protein Families | Druggable Genome, Ion Channels: Other |
Citations (1)
The use of this Antibodies has been cited in the following citations: |
---|
The sigma-1 receptor behaves as an atypical auxiliary subunit to modulate the functional characteristics of Kv1.2 channels expressed in HEK293 cells
,Abraham, MJ;Fleming, KL;Raymond, S;Wong, AYC;Bergeron, R;,
Physiol Rep
,PubMed ID 31222975
[KCNAB2]
|
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |
其它Kv beta 2产品