Dmrtb1 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Mouse
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-Dmrtb1 antibody: synthetic peptide directed towards the c terminal of mouse Dmrtb1. Synthetic peptide located within the following region: PHFLPPGYLSALHFLPPPPPPPSPPSFSLTYDTDKENTNDQDAEAPTEPS
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	38 kDa
Gene Name	DMRT-like family B with proline-rich C-terminal, 1
Database Link	NP_063925 Entrez Gene 56296 Mouse UniProt ID A2A9I7
Background	The function of this protein remains unknown.
Synonyms	DMRTB1
Note	Mouse: 100%; Rat: 81%; Human: 75%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.