COX18 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-COX18 antibody: synthetic peptide directed towards the middle region of human COX18. Synthetic peptide located within the following region: LCSSFVGLSQNLLLRSPGFRQLCRIPSTKSDSETPYKDIFAAFNTKFISR
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	37 kDa
Gene Name	COX18 cytochrome c oxidase assembly factor
Database Link	NP_776188 Entrez Gene 285521 Human UniProt ID Q8N8Q8
Background	COX18 is required for the insertion of integral membrane proteins into the mitochondrial inner membrane. COX18 is essential for the activity and assembly of cytochrome c oxidase. COX18 plays a central role in the translocation and export of the C-terminal part of the COX2 protein into the mitochondrial intermembrane space.COX18 encodes a cytochrome c oxidase (COX)-assembly protein. The S. cerevisiae Cox18 protein catalyzes the insertion of the Cox2 (MTCO2; MIM 516040) C-terminal tail into the mitochondrial inner membrane, an intermediate step in the assembly of complex IV of the mitochondrial respiratory chain (Sacconi et al., 2005 [PubMed 16212937]). [supplied by OMIM]. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-1248 AY957565.1 1-1248 1249-4523 AC095053.3 75071-78345 c
Synonyms	COX18HS
Note	Human: 100%; Rat: 93%; Pig: 86%; Horse: 86%; Rabbit: 86%; Mouse: 85%; Dog: 79%; Bovine: 79%
Reference Data
Protein Families	Transmembrane

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.