TTC9C Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-TTC9C antibody: synthetic peptide directed towards the N terminal of human TTC9C. Synthetic peptide located within the following region: MEKRLQEAQLYKEEGNQRYREGKYRDAVSRYHRALLQLRGLDPSLPSPLP
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	20 kDa
Gene Name	tetratricopeptide repeat domain 9C
Database Link	NP_776171 Entrez Gene 283237 Human UniProt ID Q8N5M4
Background	The specific function of the protein remains unknown.
Synonyms	MGC29649
Note	Dog: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Horse: 93%; Rabbit: 93%; Pig: 86%; Goat: 86%; Bovine: 86%; Guinea pig: 77%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.