C9orf75 (TPRN) Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-C9orf75 antibody: synthetic peptide directed towards the middle region of human C9orf75. Synthetic peptide located within the following region: EAMVRCGGVERWGESDTRASPCVHILSSHFQLTPASQNDLSDFRSEPALY
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	47 kDa
Gene Name	taperin
Database Link	NP_775962 Entrez Gene 286262 Human UniProt ID Q4KMQ1
Background	The specific function of C9orf75 is not yet known.
Synonyms	C9orf75; DFNB79; FLJ90254; MGC131933; RP11-350O14.7
Note	Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Guinea pig: 100%; Dog: 93%; Bovine: 93%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.