CDRT4 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-CDRT4 antibody: synthetic peptide directed towards the middle region of human CDRT4. Synthetic peptide located within the following region: TSQTVKRLIEKSKTRELECMRALEERPWASRQNKPSSVIQPKRRKSSKSS
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	17 kDa
Gene Name	CMT1A duplicated region transcript 4
Database Link	NP_775893 Entrez Gene 284040 Human UniProt ID Q8N9R6
Background	The specific function of CDRT4 is not yet known.
Synonyms	CMT1A duplicated region transcript 4; FLJ36674; MGC33988; NBLA10383; putative protein product of Nbla10383
Note	Human: 100%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.