MBD3L2 Rabbit Polyclonal Antibody
CAT#: TA331339
Rabbit Polyclonal Anti-MBD3L2 Antibody
Need it in bulk or conjugated?
Get a free quote
CNY 5250.00
CNY 3080.00
CNY 300.00
CNY 1430.00
CNY 2900.00
CNY 6650.00
CNY 9998.00
Specifications
Product Data | |
Applications | WB |
Recommend Dilution | WB |
Reactivity | Human |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for Anti-MBD3L2 antibody is: synthetic peptide directed towards the middle region of Human MBD3L2. Synthetic peptide located within the following region: EHLEKPQQLCAYRRLQALQPCSSQGEGSSPLHLESVLSILAPGTAGESLD |
Isotype | IgG |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 23 kDa |
Gene Name | methyl-CpG binding domain protein 3 like 2 |
Database Link | |
Background | This gene encodes a protein that is related to methyl-CpG-binding proteins but lacks the methyl-CpG binding domain. The protein has been found in germ cell tumors and some somatic tissues. |
Synonyms | methyl-CpG binding domain protein 3-like 2 |
Note | Human: 100% |
Reference Data |
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |