GNG3 Rabbit Polyclonal Antibody
CNY 5250.00
CNY 3080.00
CNY 300.00
CNY 1430.00
Specifications
Product Data | |
Applications | WB |
Recommend Dilution | WB |
Reactivity | Human |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for Anti-GNG3 antibody is: synthetic peptide directed towards the middle region of Human GNG3. Synthetic peptide located within the following region: IEASLCRIKVSKAAADLMTYCDAHACEDPLITPVPTSENPFREKKFFCAL |
Isotype | IgG |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 8 kDa |
Gene Name | G protein subunit gamma 3 |
Database Link | |
Background | Guanine nucleotide binding proteins are heterotrimeric signal-transducing molecules consisting of alpha, beta, and gamma subunits. The gamma subunit determines the specificity of which signaling pathways will be affected by this particular complex. The protein encoded by this gene represents the gamma subunit of both inhibitory and stimulatory complexes. |
Synonyms | gamma 3; guanine nucleotide-binding protein gamma-3 subunit; guanine nucleotide binding protein (G protein); NBP gamma-3 |
Note | Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Zebrafish: 100%; Guinea pig: 100% |
Reference Data | |
Protein Families | Druggable Genome |
Protein Pathways | Chemokine signaling pathway, Taste transduction |
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |