D2HGDH Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-D2HGDH antibody is: synthetic peptide directed towards the N-terminal region of Human D2HGDH. Synthetic peptide located within the following region: AFERIVPGGVVTDPEALQAPNVDWLRTLRGCSKVLLRPRTSEEVSHILRH
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	35 kDa
Gene Name	D-2-hydroxyglutarate dehydrogenase
Database Link	NP_689996 Entrez Gene 728294 Human UniProt ID Q8N465
Background	The function of this protein remains unknown.
Synonyms	D2HGD
Note	Human: 100%; Rat: 93%; Dog: 92%; Rabbit: 92%; Mouse: 86%; Pig: 85%; Guinea pig: 85%; Horse: 79%; Bovine: 79%; Zebrafish: 77%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.