Chmp4c Rabbit Polyclonal Antibody
CAT#: TA331315
Rabbit Polyclonal Anti-Chmp4c Antibody
Need it in bulk or conjugated?
Get a free quote
CNY 5250.00
CNY 300.00
CNY 1430.00
CNY 2900.00
Specifications
Product Data | |
Applications | WB |
Recommend Dilution | WB |
Reactivity | Mouse |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for Anti-Chmp4c antibody is: synthetic peptide directed towards the C-terminal region of Mouse Chmp4c. Synthetic peptide located within the following region: SEAFSQRVQFADGFDEAELLAELEELEQEELNKKMTSLELPNVPSSSLPA |
Isotype | IgG |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 26 kDa |
Gene Name | charged multivesicular body protein 4C |
Database Link | |
Background | Chmp4c is a probable core component of the endosomal sorting required for transport complex III (ESCRT-III) which is involved in multivesicular bodies (MVBs) formation and sorting of endosomal cargo proteins into MVBs. |
Synonyms | hSnf7-3; hVps32-3; MGC22825; Shax3; SNF7-3; Vps32-3; VPS32C |
Note | Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Dog: 92%; Yeast: 92%; Zebrafish: 92% |
Reference Data |
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |