Akirin2 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Mouse
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-Akirin2 antibody is: synthetic peptide directed towards the C-terminal region of Mouse Akirin2. Synthetic peptide located within the following region: CERLLKEREEKVREEYEEILNTKLAEQYDAFVKFTHDQIMRRYGEQPASY
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	22 kDa
Gene Name	akirin 2
Database Link	NP_001007590 Entrez Gene 433693 Mouse UniProt ID B1AXD8
Background	Akirin2 forms a complex with YWHAB that acts to repress transcription of DUSP1. It is required for embryonic development and the innate immune response. Downstream effector of the Toll-like receptor (TLR), TNF and IL-1 beta signaling pathways leading to the production of IL-6.
Synonyms	C6orf166; dJ486L4.2; FBI1; FLJ10342
Note	Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Sheep: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Zebrafish: 93%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.