Syntrophin gamma 2 (SNTG2) Rabbit Polyclonal Antibody

CAT#: TA331297

Rabbit Polyclonal Anti-SNTG2 Antibody



Need it in bulk or conjugated?
Get a free quote

CNY 5250.00


货期*
6周

规格
    • 100 ul

Product images

推荐一起购买 (4)
Transient overexpression lysate of syntrophin, gamma 2 (SNTG2)
    • 100 ug

CNY 4840.00


beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

CNY 300.00
CNY 1430.00


Recombinant protein of human syntrophin, gamma 2 (SNTG2), 20 µg
    • 20 ug

CNY 2900.00
CNY 6650.00


Recombinant protein of human syntrophin, gamma 2 (SNTG2), 100 µg
    • 100 ug

CNY 9998.00

Specifications

Product Data
Applications WB
Recommend Dilution WB
Reactivity Human
Host Rabbit
Clonality Polyclonal
Immunogen The immunogen for Anti-SNTG2 antibody is: synthetic peptide directed towards the C-terminal region of Human SNTG2. Synthetic peptide located within the following region: NVLWRFKFSQLKGSSDDGKTRVKLLFQNLDTKQIETKELEFQDLRAVLHC
Isotype IgG
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification Affinity Purified
Conjugation Unconjugated
Storage Condition Store at -20°C as received.
Predicted Protein Size 59 kDa
Gene Name syntrophin gamma 2
Background This gene encodes a protein belonging to the syntrophin family. Syntrophins are cytoplasmic peripheral membrane proteins that bind to components of mechanosenstive sodium channels and the extreme carboxy-terminal domain of dystrophin and dystrophin-related proteins. The PDZ domain of this protein product interacts with a protein component of a mechanosensitive sodium channel that affects channel gating. Absence or reduction of this protein product has been associated with Duchenne muscular dystrophy. There is evidence of alternative splicing yet the full-length nature of these variants has not been described.
Synonyms G2SYN; SYN5
Note Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Zebrafish: 100%; Dog: 93%; Pig: 86%; Guinea pig: 86%; Bovine: 79%; Rabbit: 79%
Reference Data
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
Customer Reviews 
Loading...