ITIH5 Rabbit Polyclonal Antibody
CAT#: TA331262
Rabbit Polyclonal Anti-ITIH5 Antibody
Need it in bulk or conjugated?
Get a free quote
CNY 4,628.00
CNY 300.00
CNY 1,430.00
CNY 4,840.00
Specifications
Product Data | |
Applications | WB |
Recommend Dilution | WB |
Reactivity | Human |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for Anti-ITIH5 antibody is: synthetic peptide directed towards the N-terminal region of Human ITIH5. Synthetic peptide located within the following region: ASEDQDIEFQMQIPAAAFITNFTMLIGDKVYQGEITEREKKSGDRVKEKR |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 75 kDa |
Gene Name | inter-alpha-trypsin inhibitor heavy chain family member 5 |
Database Link | |
Background | This gene encodes a heavy chain component of one of the inter-alpha-trypsin inhibitor (ITI) family members. ITI proteins are involved in extracellular matrix stabilization and in the prevention of tumor metastasis. They are also structurally related plasma serine protease inhibitors and are composed of a light chain and varying numbers of heavy chains. This family member is thought to function as a tumor suppressor in breast and thyroid cancers. Alternative splicing results in multiple transcript variants. |
Synonyms | ITI-HC5; PP14776 |
Note | Human: 100%; Rat: 93%; Rabbit: 92%; Mouse: 86%; Dog: 79%; Pig: 79%; Bovine: 79%; Guinea pig: 79% |
Reference Data |
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |