Eif2b3 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Rat
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-Eif2b3 antibody is: synthetic peptide directed towards the middle region of Rat Eif2b3. Synthetic peptide located within the following region: FRAYDASLAMLMRKGQESTEPVPGQKGKKKTVEQRDFIGVDSTGKRLLFM
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	50 kDa
Gene Name	eukaryotic translation initiation factor 2B, subunit 3 gamma
Database Link	NP_598293 Entrez Gene 171145 Rat UniProt ID P70541
Background	Eif2b3 is a guanine nucleotide exchange factor that regulates key step in protein synthesis; restores eIF2 to its active GTP-bound state.
Synonyms	EIF-2B; EIF2Bgamma
Note	Dog: 100%; Pig: 100%; Horse: 100%; Human: 100%; Bovine: 100%; Rabbit: 100%; Rat: 93%; Mouse: 93%; Zebrafish: 93%; Guinea pig: 93%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.