WHAMM Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-WHAMM antibody is: synthetic peptide directed towards the C-terminal region of Human WHAMM. Synthetic peptide located within the following region: SEAGNVKSPKCQNCHGNIPVQVFVPVGDQTHSKSSEELSLPPPPPPPPPP
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	91 kDa
Gene Name	WAS protein homolog associated with actin, golgi membranes and microtubules
Database Link	NP_001073904 Entrez Gene 123720 Human UniProt ID Q8TF30
Background	WHAMM acts as a nucleation-promoting factor (NPF) that stimulates Arp2/3-mediated actin polymerization both at the Golgi apparatus and along tubular membranes. WHAMM is involved as a regulator of Golgi positioning and morphology. WHAMM participates in vesicle transport between the reticulum endoplasmic and the Golgi complex.
Synonyms	WHAMM1; WHDC1
Note	Human: 100%; Horse: 93%; Dog: 86%; Pig: 86%; Rat: 85%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.