STK33 Rabbit Polyclonal Antibody
CAT#: TA331233
Rabbit Polyclonal Anti-STK33 Antibody
Need it in bulk or conjugated?
Get a free quote
CNY 4628.00
CNY 300.00
CNY 1430.00
CNY 2900.00
CNY 6650.00
Specifications
Product Data | |
Applications | WB |
Recommend Dilution | WB |
Reactivity | Human |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for Anti-STK33 antibody is: synthetic peptide directed towards the N-terminal region of Human STK33. Synthetic peptide located within the following region: VPPVLVVEMSQTSSIGSAESLISLERKKEKNINRDITSRKDLPSRTSNVE |
Isotype | IgG |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 58 kDa |
Gene Name | serine/threonine kinase 33 |
Database Link | |
Background | STK33 is a serine/threonine protein kinase which phosphorylates VIME. STK33 may play a specific role in the dynamic behavior of the intermediate filament cytoskeleton by phosphorylation of VIME By similarity. STK33 is not essential for the survival of KRAS-dependent AML cell lines. |
Synonyms | OTTHUMP00000178934; OTTHUMP00000178935; serine; threonine kinase 33 |
Note | Human: 100% |
Reference Data | |
Protein Families | Druggable Genome, Protein Kinase |
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |