Rab6b Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Mouse
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-Rab6b antibody is: synthetic peptide directed towards the C-terminal region of Mouse Rab6b. Synthetic peptide located within the following region: KTGYNVKQLFRRVASALPGMENVQEKSKEGMIDIKLDKPQEPPASEGGCS
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	22 kDa
Gene Name	RAB6B, member RAS oncogene family
Database Link	NP_776142 Entrez Gene 270192 Mouse UniProt ID P61294
Background	Rab6b seems to have a role in retrograde membrane traffic at the level of the Golgi complex. It may function in retrograde transport in neuronal cells.
Synonyms	RAB6B
Note	Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Zebrafish: 86%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.