LYPLAL1 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-LYPLAL1 antibody is: synthetic peptide directed towards the C-terminal region of Human LYPLAL1. Synthetic peptide located within the following region: EETNSMLKSLGVTTKFHSFPNVYHELSKTELDILKLWILTKLPGEMEKQK
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	26 kDa
Gene Name	lysophospholipase like 1
Database Link	NP_620149 Entrez Gene 127018 Human UniProt ID Q5VWZ2
Background	LYPLAL1 does not exhibit phospholipase nor triacylglycerol lipase activity. It is able to hydrolyze only short chain substrates due to its shallow active site.
Synonyms	Q96AV0
Note	Pig: 100%; Human: 100%; Guinea pig: 100%; Rabbit: 92%; Rat: 85%; Horse: 85%; Dog: 82%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.