Mitochondrial Ferritin (FTMT) Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-FTMT antibody is: synthetic peptide directed towards the middle region of Human FTMT. Synthetic peptide located within the following region: AYYFSRDDVALNNFSRYFLHQSREETEHAEKLMRLQNQRGGRIRLQDIKK
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	27 kDa
Gene Name	ferritin mitochondrial
Database Link	NP_803431 Entrez Gene 94033 Human UniProt ID Q8N4E7
Background	FTMT stores iron in a soluble, non-toxic, readily available form. FTMT is important for iron homeostasis and has ferroxidase activity. Iron is taken up in the ferrous form and deposited as ferric hydroxides after oxidation.
Synonyms	MTF
Note	Human: 100%; Pig: 93%; Rat: 93%; Rabbit: 93%; Horse: 90%; Dog: 86%; Mouse: 86%; Bovine: 86%; Guinea pig: 86%; Goat: 85%; Sheep: 85%; Zebrafish: 79%
Reference Data
Protein Pathways	Porphyrin and chlorophyll metabolism

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.