SP140 Rabbit Polyclonal Antibody
CAT#: TA331198
Rabbit Polyclonal Anti-SP140 Antibody
Need it in bulk or conjugated?
Get a free quote
CNY 5250.00
CNY 3080.00
CNY 300.00
CNY 1430.00
Specifications
Product Data | |
Applications | IHC, WB |
Recommend Dilution | WB, IHC |
Reactivity | Human |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-SP140 antibody: synthetic peptide directed towards the N terminal of human SP140. Synthetic peptide located within the following region: PEPIFRFFRENKVEIASAITRPFPFLMGLRDRSFISEQMYEHFQEAFRNL |
Isotype | IgG |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 20 kDa |
Gene Name | SP140 nuclear body protein |
Database Link | |
Background | SP140 is the nuclear body protein found specifically in all NP cells. HIV-1 infection induced its partial dispersal from nuclear bodies into cytosolic colocalization with Vif. |
Synonyms | LYSP100; LYSP100-A; LYSP100-B |
Note | Human: 100%; Dog: 86%; Pig: 86%; Horse: 86%; Rat: 77%; Mouse: 77% |
Reference Data | |
Protein Families | Druggable Genome, Transcription Factors |
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |