BUD23 Rabbit Polyclonal Antibody

CAT#: TA331196

Rabbit Polyclonal Anti-WDHD1 Antibody



Need it in bulk or conjugated?
Get a free quote

CNY 4628.00


货期*
2周

规格
    • 50 ug

Product images

推荐一起购买 (2)
Transient overexpression lysate of Williams Beuren syndrome chromosome region 22 (WBSCR22)
    • 100 ug

CNY 3080.00


beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

CNY 300.00
CNY 1430.00

Specifications

Product Data
Applications WB
Recommend Dilution WB
Reactivity Human
Host Rabbit
Clonality Polyclonal
Immunogen The immunogen for anti-WDHD1 antibody: synthetic peptide directed towards the middle region of human WDHD1. Synthetic peptide located within the following region: KQILHGDPLPLTRKSYLAWIGFSAEGTPCYVDSEGIVRMLNRGLGNTWTP
Isotype IgG
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Conjugation Unconjugated
Storage Condition Store at -20°C as received.
Predicted Protein Size 126 kDa
Gene Name Williams-Beuren syndrome chromosome region 22
Background WDHD1 contains multiple N-terminal WD40 domains and a C-terminal high mobility group (HMG) box. WD40 domains are found in a variety of eukaryotic proteins and may function as adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly. HMG boxes are found in many eukaryotic proteins involved in chromatin assembly, transcription and replication. WDHD1 may also be involved in protein-protein interactions. The protein encoded by this gene contains multiple N-terminal WD40 domains and a C-terminal high mobility group (HMG) box. WD40 domains are found in a variety of eukaryotic proteins and may function as adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly. HMG boxes are found in many eukaryotic proteins involved in chromatin assembly, transcription and replication. Alternative splicing results in two transcript variants encoding different isoforms.
Synonyms HASJ4442; HUSSY-3; MERM1; PP3381; WBMT
Note Dog: 100%; Pig: 100%; Human: 100%; Bovine: 100%; Rabbit: 100%; Rat: 93%; Horse: 93%; Mouse: 93%
Reference Data
Protein Families Druggable Genome
Protein Pathways Androgen and estrogen metabolism, Histidine metabolism, Selenoamino acid metabolism, Tyrosine metabolism
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
Customer Reviews 
Loading...