TRAFD1 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	IHC, WB
Recommend Dilution	WB, IHC
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-TRAFD1 antibody: synthetic peptide directed towards the C terminal of human TRAFD1. Synthetic peptide located within the following region: TATNHVTEGIPRLDSQPQETSPELPRRRVRHQGDLSSGYLDDTKQETANG
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	65 kDa
Gene Name	TRAF-type zinc finger domain containing 1
Database Link	NP_006691 Entrez Gene 10906 Human UniProt ID O14545
Background	TRAFD1 is a new candidate transcription factor.
Synonyms	FLN29
Note	Human: 100%; Pig: 93%; Guinea pig: 93%; Dog: 86%; Rat: 86%; Horse: 86%; Rabbit: 86%; Mouse: 85%; Bovine: 79%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.