ACSL1 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	IHC, WB
Recommend Dilution	IHC, WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-ACSL1 antibody: synthetic peptide directed towards the N terminal of human ACSL1. Synthetic peptide located within the following region: ALLDSDEPLVYFYDDVTTLYEGFQRGIQVSNNGPCLGSRKPDQPYEWLSY
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	78 kDa
Gene Name	acyl-CoA synthetase long-chain family member 1
Database Link	NP_001986 Entrez Gene 2180 Human UniProt ID P33121
Background	ACSL1 encodes an isozyme of the long-chain fatty-acid-coenzyme A ligase family. Although differing in substrate specificity, subcellular localization, and tissue distribution, all isozymes of this family convert free long-chain fatty acids into fatty acyl-CoA esters, and thereby play a key role in lipid biosynthesis and fatty acid degradation.The protein encoded by this gene is an isozyme of the long-chain fatty-acid-coenzyme A ligase family. Although differing in substrate specificity, subcellular localization, and tissue distribution, all isozymes of this family convert free long-chain fatty acids into fatty acyl-CoA esters, and thereby play a key role in lipid biosynthesis and fatty acid degradation. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Synonyms	ACS1; FACL1; FACL2; LACS; LACS1; LACS2
Note	Human: 100%; Rabbit: 100%; Dog: 92%; Pig: 92%; Rat: 85%; Mouse: 85%; Bovine: 85%; Guinea pig: 85%; Horse: 79%; Zebrafish: 77%
Reference Data
Protein Families	Transmembrane
Protein Pathways	Adipocytokine signaling pathway, Fatty acid metabolism, Metabolic pathways, PPAR signaling pathway

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.