ACSL1 Rabbit Polyclonal Antibody
CAT#: TA331164
Rabbit Polyclonal Anti-ACSL1 Antibody
Need it in bulk or conjugated? 
                            Get a free quote
                        
CNY 5250.00
CNY 3080.00
                                                
                                                
                                                
                                                    CNY 300.00 
                                                    
                                                    CNY 1430.00
                                                
                                            
Specifications
| Product Data | |
| Applications | IHC, WB | 
| Recommend Dilution | WB, IHC | 
| Reactivity | Human | 
| Host | Rabbit | 
| Clonality | Polyclonal | 
| Immunogen | The immunogen for anti-ACSL1 antibody: synthetic peptide directed towards the C terminal of human ACSL1. Synthetic peptide located within the following region: GSFEELCRNKDVKKAILEDMVRLGKDSGLKPFEQVKGITLHPELFSIDNG | 
| Isotype | IgG | 
| Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. | 
| Conjugation | Unconjugated | 
| Storage Condition | Store at -20°C as received. | 
| Predicted Protein Size | 78 kDa | 
| Gene Name | acyl-CoA synthetase long-chain family member 1 | 
| Database Link | |
| Background | ACSL1 encodes an isozyme of the long-chain fatty-acid-coenzyme A ligase family. Although differing in substrate specificity, subcellular localization, and tissue distribution, all isozymes of this family convert free long-chain fatty acids into fatty acyl-CoA esters, and thereby play a key role in lipid biosynthesis and fatty acid degradation.The protein encoded by this gene is an isozyme of the long-chain fatty-acid-coenzyme A ligase family. Although differing in substrate specificity, subcellular localization, and tissue distribution, all isozymes of this family convert free long-chain fatty acids into fatty acyl-CoA esters, and thereby play a key role in lipid biosynthesis and fatty acid degradation. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications. | 
| Synonyms | ACS1; FACL1; FACL2; LACS; LACS1; LACS2 | 
| Note | Rat: 100%; Human: 100%; Mouse: 100%; Dog: 93%; Bovine: 93%; Horse: 85%; Pig: 79%; Zebrafish: 79%; Guinea pig: 79% | 
| Reference Data | |
| Protein Families | Transmembrane | 
| Protein Pathways | Adipocytokine signaling pathway, Fatty acid metabolism, Metabolic pathways, PPAR signaling pathway | 
Documents
| Product Manuals | 
| FAQs | 
| SDS | 
Resources
| 抗体相关资料 | 
