ZNF295 (ZBTB21) Rabbit Polyclonal Antibody
CAT#: TA331129
Rabbit Polyclonal Anti-ZNF295 Antibody
Need it in bulk or conjugated?
Get a free quote
CNY 5250.00
CNY 300.00
CNY 1430.00
CNY 4840.00
Specifications
Product Data | |
Applications | WB |
Recommend Dilution | WB |
Reactivity | Human |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-ZNF295 antibody: synthetic peptide directed towards the N terminal of human ZNF295. Synthetic peptide located within the following region: DQKFRAHKNVLAASSEYFQSLFTNKENESQTVFQLDFCEPDAFDNVLNYI |
Isotype | IgG |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 119 kDa |
Gene Name | zinc finger and BTB domain containing 21 |
Database Link | |
Background | ZNF295 contains 1 BTB (POZ) domain and 8 C2H2-type zinc fingers. ZNF295 may be involved in transcriptional regulation. |
Synonyms | ZNF295 |
Note | Horse: 100%; Human: 100%; Pig: 93%; Rat: 93%; Mouse: 93%; Bovine: 93%; Rabbit: 93%; Guinea pig: 93% |
Reference Data | |
Protein Families | Transcription Factors |
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |