MYT1 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	IHC, WB
Recommend Dilution	WB, IHC
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-MYT1 antibody: synthetic peptide directed towards the N terminal of human MYT1. Synthetic peptide located within the following region: CTGSGHVRGKYSRHRSLQSCPLAKKRKLEGAEAEHLVSKRKSHPLKLALD
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	122 kDa
Gene Name	myelin transcription factor 1
Database Link	NP_004526 Entrez Gene 4661 Human UniProt ID Q01538
Background	The protein encoded by this gene is a member of a family of neural specific, zinc finger-containing DNA-binding proteins. The protein binds to the promoter regions of proteolipid proteins of the central nervous system and plays a role in the developing nervous system. [provided by RefSeq, Jul 2008]
Synonyms	C20orf36; MTF1; MYTI; NZF2; PLPB1; ZC2H2C1; ZC2HC4A
Note	Rat: 100%; Horse: 100%; Human: 100%; Dog: 92%; Rabbit: 92%; Pig: 85%; Mouse: 85%; Bovine: 85%; Guinea pig: 85%
Reference Data
Protein Families	Transcription Factors

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.