MLLT1 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-MLLT1 antibody: synthetic peptide directed towards the middle region of human MLLT1. Synthetic peptide located within the following region: EESNSEDEASFKSESAQSSPSNSSSSSDSSSDSDFEPSQNHSQGPLRSMV
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	62 kDa
Gene Name	myeloid/lymphoid or mixed-lineage leukemia; translocated to, 1
Database Link	NP_005925 Entrez Gene 4298 Human UniProt ID Q03111
Background	MLLT1 is a homolog of the yeast SWI/SNF subunit, ANC1/TFG3. Moreover, MLLT0 is a fusion partner for the gene product of MLL that is a common target for chromosomal translocations in human acute leukemia
Synonyms	ENL; LTG19; YEATS1
Note	Rat: 100%; Human: 100%; Dog: 93%; Pig: 93%; Mouse: 93%; Bovine: 93%
Reference Data
Protein Families	Druggable Genome, Transcription Factors

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.