VSIG10 Rabbit Polyclonal Antibody
CAT#: TA331086
Rabbit polyclonal Anti-FLJ20674 Antibody
Need it in bulk or conjugated?
Get a free quote
CNY 5250.00
CNY 3080.00
CNY 300.00
CNY 1430.00
Specifications
Product Data | |
Applications | WB |
Recommend Dilution | WB |
Reactivity | Human |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-FLJ20674 antibody: synthetic peptide directed towards the N terminal of human FLJ20674. Synthetic peptide located within the following region: LNVTQWFQVWLQVASGPYQIEVHIVATGTLPNGTLYAARGSQVDFSCNSS |
Isotype | IgG |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Purification | Affinity Purified |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 59 kDa |
Gene Name | V-set and immunoglobulin domain containing 10 |
Database Link | |
Background | The function of this protein remains unknown. |
Synonyms | FLJ20674; MGC1013 |
Note | Rat: 100%; Human: 100%; Mouse: 100%; Rabbit: 93%; Dog: 92%; Pig: 92%; Horse: 92%; Bovine: 92% |
Reference Data | |
Protein Families | Transmembrane |
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |