Tmem165 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Mouse
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-Tmem165 antibody is: synthetic peptide directed towards the N-terminal region of Mouse Tmem165. Synthetic peptide located within the following region: MAAAARGSGRAPTRRLLVLLLLQLLWAPAGVRAGPEEDLSHRNQEPPAPA
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	35 kDa
Gene Name	transmembrane protein 165
Database Link	NP_035756 Entrez Gene 21982 Mouse UniProt ID P52875
Background	The function of this protein remains unknown.
Synonyms	TMPT27; TPARL
Note	Dog: 100%; Human: 100%; Rat: 93%; Mouse: 93%; Bovine: 93%; Pig: 85%; Guinea pig: 85%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.