C6orf140 (GLYATL3) Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-GLYATL3 antibody is: synthetic peptide directed towards the C-terminal region of Human GLYATL3. Synthetic peptide located within the following region: WSITDQFATMCHGYTLPEHRRKGYSRLVALTLARKLQSRGFPSQGNVLDD
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	31 kDa
Gene Name	glycine-N-acyltransferase like 3
Database Link	NP_001010904 Entrez Gene 389396 Human UniProt ID Q5SZD4
Background	The exact function of C6orf140 remains unknown.
Synonyms	bA28H17.2; C6orf140
Note	Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Guinea pig: 100%; Bovine: 93%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.