Gstt4 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-GSTT4 antibody is: synthetic peptide directed towards the C-terminal region of Human GSTT4. Synthetic peptide located within the following region: LAEWRMQVELNIGSGLFREAHDRLMQLADWDFSTLDSMVKENISELLKKS
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	26 kDa
Gene Name	glutathione S-transferase, theta 4
Database Link	NP_083748 Entrez Gene 75886 Mouse UniProt ID Q9D4P7
Background	Conjugation of reduced glutathione to a wide number of exogenous and endogenous hydrophobic electrophiles.
Synonyms	4930583C14Rik; AI507011
Note	Human: 93%; Dog: 79%; Pig: 79%; Rat: 79%; Horse: 79%; Rabbit: 79%; Guinea pig: 79%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.