Transglutaminase 6 (TGM6) Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-TGM6 antibody: synthetic peptide directed towards the middle region of human TGM6. Synthetic peptide located within the following region: KKIGRCISTKAVGSDSRVDITDLYKYPEGSRKERQVYSKAVNRLFGVEAS
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	69 kDa
Gene Name	transglutaminase 6
Database Link	NP_945345 Entrez Gene 343641 Human UniProt ID O95932
Background	TGM6 belongs to the transglutaminase superfamily and catalyzes the cross-linking of proteins and the conjugation of polyamines to proteins.
Synonyms	dJ734P14.3; SCA35; TG6; TGM3L; TGY
Note	Human: 100%; Mouse: 100%; Bovine: 100%; Dog: 93%; Rat: 93%; Rabbit: 93%; Pig: 86%; Horse: 86%; Guinea pig: 86%; Zebrafish: 79%
Reference Data
Protein Families	Druggable Genome

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.