SULT1A1 Rabbit Polyclonal Antibody
CAT#: TA331008
Rabbit polyclonal Anti-SULT1A1 Antibody
Need it in bulk or conjugated?
Get a free quote
CNY 5250.00
CNY 3080.00
CNY 2900.00
CNY 6650.00
CNY 9998.00
Specifications
Product Data | |
Applications | IHC, WB |
Recommend Dilution | WB |
Reactivity | Human |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-SULT1A1 antibody: synthetic peptide directed towards the N terminal of human SULT1A1. Synthetic peptide located within the following region: ELIQDTSRPPLEYVKGVPLIKYFAEALGPLQSFQARPDDLLISTYPKSGT |
Isotype | IgG |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Purification | Affinity Purified |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 34 kDa |
Gene Name | sulfotransferase family 1A member 1 |
Database Link | |
Background | Sulfotransferase enzymes catalyze the sulfate conjugation of many hormones, neurotransmitters, drugs, and xenobiotic compounds. These cytosolic enzymes are different in their tissue distributions and substrate specificities. The gene structure (number and length of exons) is similar among family members. SULT1A1 is one of two phenol sulfotransferases with thermostable enzyme activity. Sulfotransferase enzymes catalyze the sulfate conjugation of many hormones, neurotransmitters, drugs, and xenobiotic compounds. These cytosolic enzymes are different in their tissue distributions and substrate specificities. The gene structure (number and length of exons) is similar among family members. This gene encodes one of two phenol sulfotransferases with thermostable enzyme activity. Multiple alternatively spliced variants that encode two isoforms have been identified for this gene. |
Synonyms | HAST1; HAST2; P-PST; PST; ST1A1; ST1A3; STP; STP1; TSPST1 |
Note | Horse: 100%; Human: 100%; Bovine: 100%; Rabbit: 100%; Dog: 93%; Pig: 93%; Rat: 93%; Mouse: 86%; Zebrafish: 86%; Guinea pig: 86% |
Reference Data | |
Protein Pathways | Sulfur metabolism |
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |
其它SULT1A1产品