GSTA5 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-GSTA5 antibody: synthetic peptide directed towards the middle region of human GSTA5. Synthetic peptide located within the following region: QPEERDAKTALVKEKIKNRYFPAFEKVLKSHRQDYLVGNKLSWADIHLVE
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	26 kDa
Gene Name	glutathione S-transferase alpha 5
Database Link	NP_714543 Entrez Gene 221357 Human UniProt ID Q7RTV2
Background	GSTA5 belongs to the GST superfamily, alpha family. It contains 1 GST C-terminal domain and 1 GST N-terminal domain. The exact functions of GSTA5 remain unknown.
Synonyms	glutathione S-transferase A5; glutathione S-transferase alpha 5; glutathione transferase A5; OTTHUMP00000016610
Note	Human: 100%; Bovine: 100%; Rabbit: 100%; Dog: 93%; Pig: 93%; Rat: 93%; Horse: 93%; Sheep: 93%; Mouse: 92%; Guinea pig: 86%
Reference Data
Protein Pathways	Drug metabolism - cytochrome P450, Glutathione metabolism, Metabolism of xenobiotics by cytochrome P450

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.