GSTA5 Rabbit Polyclonal Antibody
CAT#: TA330990
Rabbit polyclonal Anti-GSTA5 Antibody
Need it in bulk or conjugated?
Get a free quote
CNY 5250.00
CNY 300.00
CNY 1430.00
CNY 2900.00
CNY 6650.00
CNY 9998.00
Specifications
Product Data | |
Applications | WB |
Recommend Dilution | WB |
Reactivity | Human |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-GSTA5 antibody: synthetic peptide directed towards the middle region of human GSTA5. Synthetic peptide located within the following region: QPEERDAKTALVKEKIKNRYFPAFEKVLKSHRQDYLVGNKLSWADIHLVE |
Isotype | IgG |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Purification | Affinity Purified |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 26 kDa |
Gene Name | glutathione S-transferase alpha 5 |
Database Link | |
Background | GSTA5 belongs to the GST superfamily, alpha family. It contains 1 GST C-terminal domain and 1 GST N-terminal domain. The exact functions of GSTA5 remain unknown. |
Synonyms | glutathione S-transferase A5; glutathione S-transferase alpha 5; glutathione transferase A5; OTTHUMP00000016610 |
Note | Human: 100%; Bovine: 100%; Rabbit: 100%; Dog: 93%; Pig: 93%; Rat: 93%; Horse: 93%; Sheep: 93%; Mouse: 92%; Guinea pig: 86% |
Reference Data | |
Protein Pathways | Drug metabolism - cytochrome P450, Glutathione metabolism, Metabolism of xenobiotics by cytochrome P450 |
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |