LYK5 (STRADA) Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-LYK5 antibody: synthetic peptide directed towards the C terminal of human LYK5. Synthetic peptide located within the following region: AEELTMSPSRSVANSGLSDSLTTSTPRPSNGDSPSHPYHRTFSPHFHHFV
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	44 kDa
Gene Name	STE20-related kinase adaptor alpha
Database Link	NP_001003787 Entrez Gene 92335 Human UniProt ID Q7RTN6
Background	LYK5 belongs to the protein kinase superfamily, STE Ser/Thr protein kinase family, STE20 subfamily. It contains 1 protein kinase domain. LYK5 is a pseudokinase which, in complex with CAB39, binds to and activates STK11. It relocates STK11 from the nucleus to the cytoplasm and plays an essential role in STK11-mediated G1 cell cycle arrest.
Synonyms	LYK5; NY-BR-96; PMSE; Stlk; STRAD
Note	Human: 100%; Mouse: 100%; Rabbit: 100%; Dog: 93%; Pig: 93%; Rat: 93%; Horse: 93%; Sheep: 93%; Bovine: 93%; Guinea pig: 93%
Reference Data
Protein Families	Druggable Genome, Protein Kinase
Protein Pathways	mTOR signaling pathway

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.