CHST13 Rabbit Polyclonal Antibody

CAT#: TA330983

Rabbit polyclonal Anti-CHST13 Antibody



Need it in bulk or conjugated?
Get a free quote

CNY 5250.00


货期*
6周

规格
    • 100 ul

Product images

推荐一起购买 (2)
Transient overexpression lysate of carbohydrate (chondroitin 4) sulfotransferase 13 (CHST13)
    • 100 ug

CNY 3080.00


beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

CNY 300.00
CNY 1430.00

Specifications

Product Data
Applications WB
Recommend Dilution WB
Reactivity Human
Host Rabbit
Clonality Polyclonal
Immunogen The immunogen for anti-CHST13 antibody: synthetic peptide directed towards the N terminal of human CHST13. Synthetic peptide located within the following region: ALGSSWLGGEKRSPLQKLYDLDQDPRSTLAKVHRQRRDLLNSACSRHSRR
Isotype IgG
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification Affinity Purified
Conjugation Unconjugated
Storage Condition Store at -20°C as received.
Predicted Protein Size 39 kDa
Gene Name carbohydrate sulfotransferase 13
Background CHST13 catalyzes the transfer of sulfate to position 4 of the N-acetylgalactosamine (GalNAc) residue of chondroitin. Chondroitin sulfate constitutes the predominant proteoglycan present in cartilage and is distributed on the surfaces of many cells and extracellular matrices. It transfers sulfate to the C4 hydroxyl of beta1,4-linked GalNAc that is substituted with a beta-linked glucuronic acid at the C-3 hydroxyl. C4ST3 transfers sulfate to the C-4 hydroxyl of beta-1,4-linked GalNAc flanked by GlcUA residues in chondroitin (Kang et al., 2002 [PubMed 12080076]). [supplied by OMIM].C4ST3 transfers sulfate to the C-4 hydroxyl of beta-1,4-linked GalNAc flanked by GlcUA residues in chondroitin (Kang et al., 2002 [PubMed 12080076]). [supplied by OMIM]
Synonyms C4ST3
Note Human: 100%; Bovine: 79%
Reference Data
Protein Families Transmembrane
Protein Pathways Chondroitin sulfate biosynthesis, Sulfur metabolism
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
Customer Reviews 
Loading...