MAP4K4 Rabbit Polyclonal Antibody

CAT#: TA330965

Rabbit polyclonal Anti-MAP4K4 Antibody



Need it in bulk or conjugated?
Get a free quote

CNY 5250.00


货期*
6周

规格
    • 100 ul

Product images

推荐一起购买 (2)
beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

CNY 300.00
CNY 1430.00


Transient overexpression lysate of mitogen-activated protein kinase kinase kinase kinase 4 (MAP4K4), transcript variant 2
    • 100 ug

CNY 4840.00

Specifications

Product Data
Applications IHC, WB
Recommend Dilution WB, IHC
Reactivity Human
Host Rabbit
Clonality Polyclonal
Immunogen The immunogen for anti-MAP4K4 antibody: synthetic peptide directed towards the N terminal of human MAP4K4. Synthetic peptide located within the following region: PFIRDQPNERQVRIQLKDHIDRTRKKRGEKDETEYEYSGSEEEEEEVPEQ
Isotype IgG
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification Affinity Purified
Conjugation Unconjugated
Storage Condition Store at -20°C as received.
Predicted Protein Size 133 kDa
Gene Name mitogen-activated protein kinase kinase kinase kinase 4
Background MAP4K4 is the serine/threonine kinase that may play a role in the response to environmental stress and cytokines such as TNF-alpha. MAP4K4 appears to act upstream of the JUN N-terminal pathway.The protein encoded by this gene is a member of the serine/threonine protein kinase family. This kinase has been shown to specifically activate MAPK8/JNK. The activation of MAPK8 by this kinase is found to be inhibited by the dominant-negative mutants of MAP3K7/TAK1, MAP2K4/MKK4, and MAP2K7/MKK7, which suggests that this kinase may function through the MAP3K7-MAP2K4-MAP2K7 kinase cascade, and mediate the TNF-alpha signaling pathway. Alternatively spliced transcript variants encoding different isoforms have been identified.
Synonyms FLH21957; HEL-S-31; HGK; MEKKK4; NIK
Note Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Zebrafish: 100%; Guinea pig: 100%
Reference Data
Protein Families Druggable Genome, Protein Kinase
Protein Pathways MAPK signaling pathway
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
Customer Reviews 
Loading...