C6orf223 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-MGC45491 antibody: synthetic peptide directed towards the middle region of human MGC45491. Synthetic peptide located within the following region: CRPLRPLLGFRESDSAKPASLRLLQHTPSARRNYRIAGARLMRSNYPPPL
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	26 kDa
Gene Name	chromosome 6 open reading frame 223
Database Link	NP_001165463 Entrez Gene 221416 Human
Background	The exact function of MGC45491 remains unknown.
Synonyms	MGC45491
Note	Human: 100%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.