Lrwd1 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Rat
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-LOC304396 antibody is: synthetic peptide directed towards the middle region of RAT LOC304396. Synthetic peptide located within the following region: EPLHFLQCHSRNNSPKDLETQLWACAFEPAREEGHSGATSQTVATCGGEA
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	45 kDa
Gene Name	leucine-rich repeats and WD repeat domain containing 1
Database Link	NP_001014003 Entrez Gene 304396 Rat
Background	The function of this protein remains unknown.
Synonyms	DKFZp434K1815
Note	Human: 100%; Yeast: 100%; Dog: 92%; Pig: 92%; Horse: 92%; Rabbit: 92%; Rat: 85%; Mouse: 85%; Bovine: 85%; Guinea pig: 85%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.