TMEM146 (CATSPERD) Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-TMEM146 antibody: synthetic peptide directed towards the middle region of human TMEM146. Synthetic peptide located within the following region: NPHSLGFQATFYENGYTSDGNTKYKLDIFLKQQQHWGRTDSNFTSSLKKA
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	90 kDa
Gene Name	cation channel sperm associated auxiliary subunit delta
Database Link	NP_689997 Entrez Gene 257062 Human UniProt ID Q86XM0
Background	TMEM146 is a single-pass type I membrane protein. The functions of TMEM146 remain unknown.
Synonyms	TMEM146
Note	Human: 100%; Pig: 83%; Horse: 83%
Reference Data
Protein Families	Transmembrane

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.