UPK3BL1 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-UPK3BL antibody is: synthetic peptide directed towards the C-terminal region of Human UPK3BL. Synthetic peptide located within the following region: PTKIGCNHPLPGPGPYRVKFLVMNDEGPVAETKWSSDTRLQQAQALRAVP
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	28 kDa
Gene Name	uroplakin 3B-like
Database Link	NP_001107875 Entrez Gene 100134938 Human UniProt ID B0FP48
Background	The function of this protein remains unknown.
Synonyms	UPLP
Note	Human: 100%; Pig: 83%; Horse: 83%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.