ZNF680 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-ZNF680 antibody is: synthetic peptide directed towards the middle region of Human ZNF680. Synthetic peptide located within the following region: IRIHTRENSYKCEECGKVLNWFSELIKHKGIHMGEKPYKCEECGKAFNQS
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	58 kDa
Gene Name	zinc finger protein 680
Database Link	NP_848653 Entrez Gene 340252 Human UniProt ID Q8NEM1
Background	ZNF680 belongs to the krueppel C2H2-type zinc-finger protein family. It contains 12 C2H2-type zinc fingers and 1 KRAB domain. ZNF680 may be involved in transcriptional regulation.
Synonyms	FLJ90430
Note	Human: 100%
Reference Data
Protein Families	Transcription Factors

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.