RFX8 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-RFX8 antibody is: synthetic peptide directed towards the C-terminal region of Human RFX8. Synthetic peptide located within the following region: AIINQGTLATSKKALASDRSGADELENNPEMKCLRNLISLLGTSTDLRVF
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	64 kDa
Gene Name	RFX family member 8, lacking RFX DNA binding domain
Database Link	NP_001139136 Entrez Gene 731220 Human UniProt ID Q6ZV50
Background	RFX8 may be a transcription factor.
Synonyms	FLJ16242; FLJ42986; FLJ52890
Note	Human: 100%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.