KLLN Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-KLLN antibody is: synthetic peptide directed towards the middle region of Human KLLN. Synthetic peptide located within the following region: DSSGGKSSSSFARGALAWCRQRNPNPSCAAAETGARTSLPKERCRGWRLG
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	19 kDa
Gene Name	killin, p53-regulated DNA replication inhibitor
Database Link	NP_001119521 Entrez Gene 100144748 Human UniProt ID B2CW77
Background	The protein encoded by this intronless gene is found in the nucleus, where it can inhibit DNA synthesis and promote S phase arrest coupled to apoptosis. The expression of this DNA binding protein is upregulated by transcription factor p53.
Synonyms	CWS4; KILLIN
Note	Human: 100%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.