FAM47E Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-FAM47E antibody is: synthetic peptide directed towards the C-terminal region of Human FAM47E. Synthetic peptide located within the following region: RYGAWYLNPKLWKKQRVDEPLVDPEVSHKAQEENFKKELQEQSIFKKAMD
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	38 kDa
Gene Name	family with sequence similarity 47 member E
Database Link	NP_001130042 Entrez Gene 100129583 Human UniProt ID Q6ZV65
Background	The function of this protein remains unknown.
Synonyms	FLJ34958
Note	Human: 100%; Bovine: 93%; Dog: 86%; Pig: 75%; Rat: 75%; Horse: 75%; Mouse: 75%; Rabbit: 75%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.